SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246196.MSMEG_0586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246196.MSMEG_0586
Domain Number 1 Region: 16-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000647
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246196.MSMEG_0586
Sequence length 129
Comment (Mycobacterium smegmatis MC2 155)
Sequence
MVCDGASMRAHHRQLATVVTVKGAIGSENLDQISAYVRRLVIPEKSIVLDLSGVNSFAPQ
AVSLFYAIDARCGELGVDWAVVASGAVLAELDDDDAGVPLTASVPDALHHFAEGTMARRR
LLPLLVKSA
Download sequence
Identical sequences A0QQ09 L8FKS3
WP_003892006.1.100356 WP_003892006.1.19768 WP_003892006.1.23286 WP_003892006.1.56412 WP_003892006.1.74845 WP_003892006.1.94974 WP_003892006.1.96786 YP_884997.1.77314 gi|118469263|ref|YP_884997.1| gi|118469263|ref|YP_884997.1| 246196.MSMEG_0586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]