SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246196.MSMEG_1910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246196.MSMEG_1910
Domain Number 1 Region: 127-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.32e-72
Family SCOPe 0.0000000132
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.87e-48
Family SCOPe 0.00000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 246196.MSMEG_1910
Sequence length 367
Comment (Mycobacterium smegmatis MC2 155)
Sequence
MKIVAIGAIPFSIPYTKPLRFASGEVHAAEHVLVRVHTDDGIVGVAEAPPRPFTYGETQT
GIVAVIEQYFAPALIGLTLTEREVAHTRMARTVGNPTAKAAIDMAMWDALGQSLRLSVSE
MLGGYTDRMRVSHMLGFDDPVKMVAEAERIRETYGINTFKVKVGRRPVQLDTAVVRALRE
RFGDAIELYVDGNRGWSAAESLRAMREMADLDLLFAEELCPADDVLSRRRLVGQLDMPFI
ADESVPTPADVTREVLGGSATAISIKTARTGFTGSTRVHHLAEGLGLDMVMGNQIDGQIG
TACTVSFGTAFERTSRHAGELSNFLDMSDDLLTVPLQISDGQLHRRPGPGLGIEIDPDKL
AHYRTDN
Download sequence
Identical sequences A0QTN8 I7FZ22
246196.MSMEG_1910 3dg3_A 3dg6_A 3dg7_A 3dg7_B 3dg7_C 3dg7_D WP_011728002.1.100356 WP_011728002.1.19768 WP_011728002.1.23286 WP_011728002.1.56412 WP_011728002.1.74845 YP_886276.1.77314 gi|118470554|ref|YP_886276.1| gi|118470554|ref|YP_886276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]