SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246196.MSMEG_4646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246196.MSMEG_4646
Domain Number 1 Region: 239-499
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.83e-61
Family PFOR Pyr module 0.064
Further Details:      
 
Domain Number 2 Region: 515-617
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.14e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.069
Further Details:      
 
Domain Number 3 Region: 21-230
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246196.MSMEG_4646
Sequence length 651
Comment (Mycobacterium smegmatis MC2 155)
Sequence
MGDNGNGTGAAPRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLATQPNYPAEIR
APQGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKANVSDLPRGGLIIANSDEFT
KRNLAKVGYDANPLETDELSDYVVHSVAMTTLTLGAVESIGASKKDGQRAKNMFALGLLS
WMYGRELEASEAFIREKFARKPEIAEANVLALKAGWNYGETTEAFATTYEVSPAKLPAGE
YRQISGNTALAYGIVAAGHLSDLQVVLGTYPITPASDILHELSKHKNFNVLTFQAEDEIA
GIGAAIGASYGGALGVTSTSGPGVSLKSEAIGLAVMTELPLIVIDVQRGGPSTGLPTKTE
QADLLQALFGRNGESPVAVVAPRSPSDCFDIAVEAARIAINYHTPVIILSDGAVANGSEP
WRIPDITTYPRIEHTFAKAGEPFQPYARDPETLARQFAIPGTPGLEHRIGGLESANGSGN
ISYEPKNHDLMVRLRQEKIAGVTVPDLEVDDPTGDAELLMLGWGSSYGPIGEACRRARRK
GIKVAQAHLRHLNPFPANLGEVLARYPKVVVPEMNLGQLALLLRGRFLVDVQSVTKVEGM
AFLADEIEGIIDAALEGTLAEKENDKAKFARLAAATVEGEANEESAVGANA
Download sequence
Identical sequences A0R171 I7G5Q2 L8FB10
246196.MSMEG_4646 gi|118473956|ref|YP_888909.1| gi|118473956|ref|YP_888909.1| WP_003896022.1.100356 WP_003896022.1.19768 WP_003896022.1.23286 WP_003896022.1.56412 WP_003896022.1.74845 WP_003896022.1.94974 YP_888909.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]