SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_0780 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246197.MXAN_0780
Domain Number 1 Region: 33-204
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.15e-23
Family Clp protease, ClpP subunit 0.071
Further Details:      
 
Domain Number 2 Region: 383-450
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000183
Family NfeD domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_0780
Sequence length 451
Comment (Myxococcus xanthus DK 1622)
Sequence
MHQRARWRLAAPALLCVLMAGLLASAANAPTRNGQPTVARCDLEGVVDAGTGGYLSDCVA
RATAAGHDALLVRLDTPGGSLEATRHIVRAFLASPVPVLVWVGPSGAHAGSAGVFIALAS
NVAAMAPGTNIGAAHPVVGPSGQSPEAVGGEQMARKVENDAVAFAESIAQQRGRNVQWAA
SAVRDSVSVSADDARALRVVEYVTPTEADFLAQADGRQVTVAGGESVRLSTRDAHIVTME
PTLSQRTVHALANPAIVYLLFLVAGLGLVVELSHPGAIAPGLIGVVALVLALVASSALPV
RAGAVLLMMAGVALIVAELFVTSGLLGAVGVVLLGLGGLFLVDRFNPEWFVDRSFQVSWT
WLVPTTVALGGAAAYVVYRSAQTRRLPQRGGDLGLVGERGTALAPVTPESGEVFVHGERW
RATSTAPIRSGAHVVVRGMEGLTLFVDEVPT
Download sequence
Identical sequences Q1DE77
gi|108758257|ref|YP_629046.1| WP_011550906.1.71322 WP_011550906.1.72039 WP_011550906.1.75941 WP_011550906.1.91991 246197.MXAN_0780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]