SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_2316 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246197.MXAN_2316
Domain Number 1 Region: 157-222
Classification Level Classification E-value
Superfamily EF-hand 5.83e-18
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_2316
Sequence length 224
Comment (Myxococcus xanthus DK 1622)
Sequence
MGWGACRCLDPNEGALRCAPSREGFIMATKSRKTAVAKKSSRRTATAKKATPKKAAGKAH
GAKKTTTKKKTTAKKTTAKKAAAKKAPAKKTTAKKAAAKKTTAKKATTRKAATRRTSKSR
RERPTTGVPFVEQVETTSAGLQPLAPTHAAVDEFTSSGDEVLDIFQRYDRDRTGTIDRAE
FARLLEALGQNISDEELEIAVDIVDTDRTGKISWNEFKAWWNSR
Download sequence
Identical sequences Q1D9Y7
WP_011552391.1.71322 WP_011552391.1.72039 WP_011552391.1.75941 WP_011552391.1.91991 gi|108761151|ref|YP_630536.1| 246197.MXAN_2316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]