SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_2478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  246197.MXAN_2478
Domain Number - Region: 19-53
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000978
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_2478
Sequence length 89
Comment (Myxococcus xanthus DK 1622)
Sequence
MIQGSGRCHYHPERAGLGVCVECRRVICRECTTQFEGINRCASCLDQRLKALEGPGERRE
WSAGNVVLALMSLALVFGGILLLAQVAAS
Download sequence
Identical sequences A0A1G6YVW6 Q1D9H5
246197.MXAN_2478 gi|108757783|ref|YP_630698.1| WP_011552550.1.71322 WP_011552550.1.72039 WP_011552550.1.75941 WP_011552550.1.91868 WP_011552550.1.91991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]