SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_5613 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246197.MXAN_5613
Domain Number 1 Region: 19-118
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_5613
Sequence length 128
Comment (Myxococcus xanthus DK 1622)
Sequence
MNQVLEVRPGLAGAAIAAGRVETLMLEGELSEQDLLELCDDLGRKLQRGTRQVVLDFGDV
GHLNYRGVKPLMARTDAFRRAGGDVKLSGLSPYLAAIFRAAGAHDCFEIYPHMNDARAAF
ALARAPFV
Download sequence
Identical sequences Q1D0S1
gi|108758179|ref|YP_633752.1| WP_011555567.1.71322 WP_011555567.1.72039 WP_011555567.1.75941 WP_011555567.1.91991 246197.MXAN_5613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]