SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246197.MXAN_7296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  246197.MXAN_7296
Domain Number - Region: 17-128
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0392
Family Sfri0576-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246197.MXAN_7296
Sequence length 139
Comment (Myxococcus xanthus DK 1622)
Sequence
MKQQPRDWQCGAHRAHFEEPDTLVAEFNGLITLEEVKEVVTLYQQTATDHGQYYLIADIG
RSQLEAAGRRYMSEKASSDWYHAILYVGADIVMQTFVKAIALALLFTGKSTFETVFVKTQ
DEARAWVAQHRLRLKSKAG
Download sequence
Identical sequences A0A1G7JEW7 Q1CW14
gi|108758465|ref|YP_635409.1| 246197.MXAN_7296 WP_011557215.1.71322 WP_011557215.1.72039 WP_011557215.1.75941 WP_011557215.1.91868 WP_011557215.1.91991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]