SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246200.SPO1421 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246200.SPO1421
Domain Number 1 Region: 20-214
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-26
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Weak hits

Sequence:  246200.SPO1421
Domain Number - Region: 224-246
Classification Level Classification E-value
Superfamily Zinc hairpin stack 0.0017
Family Zinc hairpin stack 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246200.SPO1421
Sequence length 257
Comment (Ruegeria pomeroyi DSS 3)
Sequence
MHTVKAAVRKLYVGRDPGSVRFRYGLIVFDLSTILFFIATAHLPHGPVLTALSVVIGFVI
LCDFSARLWIAKRRREFLTRIYTIADIIVILSLLLDPFLTQSLAFLRILRGLRLIHSYHL
LHDLRRDSQFFRTHEDAIVAAVNLLVFIFLTTMAVLVFFIPPGSRETPYIDALYFTMATL
TTTGFGDITLGTPAGKLFSVFVMVVGVALFVRLAQAIFSPQKVRYRCPDCGLFRHDPDAV
HCKHCGGLLNIETGGAG
Download sequence
Identical sequences Q5LTJ3
WP_011047158.1.46818 246200.SPO1421 gi|56696305|ref|YP_166662.1| 1914M

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]