SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246200.SPO1460 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246200.SPO1460
Domain Number 1 Region: 23-234
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000693
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.038
Further Details:      
 
Weak hits

Sequence:  246200.SPO1460
Domain Number - Region: 370-437
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0331
Family Cystathionine synthase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246200.SPO1460
Sequence length 517
Comment (Ruegeria pomeroyi DSS 3)
Sequence
MTRMDGVMTPQGADSARAITKLVVMAVGGQGGGVLTGWIEAVARAAGRAVQATSVAGVAQ
RTGATIYYIEIAPEGVAAPVFSLAPAAGDVDILIAAEMMEAGRAIQRGFVTPDRTVLIAS
EHRALAVSEKMVPGNGIAQADEVMAAAEIAAARFLSADMERLAVAKGSVISASLFGALAG
SGALPFPRDAFETAIRNSGKGVEASLAAFTAGFEAVSAGPAQPEAAVTAKTPAEPAVQGP
SAQLAAWAALTARVEALPADAREMALAGLRKVVAFQDCTYGGEYLDRLTALARQDEPAQG
FELTREAAKHIANAMAYDDVIRVAGRKTRAARRARIDAEMGRSPQQGMQVTEFLHPRAEE
ISSLLPAGLGARVAASPRWMARLDRWFGHGRRIRSDRVSGFLQLYLLAGLRGYRRRTLRH
AQEQAHLEAWLHKVGETRERDYDLAMELLRCRRLIKGYSDTHARGLSKFDRVMAGADLVA
GRVDAADWVRRLREAALQDEEGRALDGALKTVRSFSS
Download sequence
Identical sequences Q5LTF4
gi|56696344|ref|YP_166701.1| WP_011047197.1.46818 246200.SPO1460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]