SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246200.SPO1595 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246200.SPO1595
Domain Number 1 Region: 112-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.1e-49
Family D-glucarate dehydratase-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.91e-29
Family Enolase N-terminal domain-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 246200.SPO1595
Sequence length 367
Comment (Ruegeria pomeroyi DSS 3)
Sequence
MKIARLNLWHVPLTSHTAYYMADGKTCDTVETVVIAVQTDTGITGWGEVCPIPHYLPAYA
RGVAPALTELAPVILGADPVGVGALMERVDAVLHGHPYAKSALDIALWDITGQVAGLPLH
ALLGGWRAADMPLYHSITCIAPDDMARIAREAQAQGITQFQVKLGASGDWQTDVERLAKV
REAVGPGPLVYGDWNCGATSLEAIRVGRAVAQLDIMLEQPCATLEDCARVQRATGLPMKI
DELAHDTASLLTAHRLGIMDAVALKLSKFGGLSTTRRARDLCLHLGARMCIEDTWGSDIT
TAALLHLGAASEPGRVLNVCDLSGYVAPRLAPDAPVRANGRIAPPEGAGLGITVDRGALG
VPDLILD
Download sequence
Identical sequences Q5LT19
375451 NYSGXRC-9394a gi|56696479|ref|YP_166836.1| 246200.SPO1595 WP_011047332.1.46818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]