SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 246200.SPO2414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  246200.SPO2414
Domain Number 1 Region: 114-387
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.1e-69
Family D-glucarate dehydratase-like 0.00021
Further Details:      
 
Domain Number 2 Region: 1-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.62e-31
Family Enolase N-terminal domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 246200.SPO2414
Sequence length 389
Comment (Ruegeria pomeroyi DSS 3)
Sequence
MRITAIRSHVLQTDMPEELGYSQQYYARRTAHIVEVQTDEGITGWGECFGPGTVALANKT
IVEKVIQPMVLGDDPLDRDVIWHKVYNLLRDHGQKGMPIQALSGVDIALWDIAGKVTGLP
LHKLIGGAHRTRVQAYGYGMMLKRESTAAHLARFADEAAAIRDMGFAATKMKVGLGARED
VKLCEAVRRGVGEGFDFMVDANHCYTTSDAFFVGRALEELGAYWFEEPVAPEDLDGYRAL
RAGLKVNISGGEAEFTRWGWRRLLEAQGLDIAQPEVCALGGITEYLRVLALCHAHFVPVV
NHVWGSAVAVATNLHLLAAMPPMPGGLFPREPWLEFDTTLNIFRDSLLTEPLDIQGQVAR
NGGWIAVPDGPGLGVEPDRAFLSAYAFAG
Download sequence
Identical sequences Q5LQS4
246200.SPO2414 gi|56697265|ref|YP_167631.1| WP_011048123.1.46818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]