SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 247156.nfa15120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  247156.nfa15120
Domain Number 1 Region: 25-75
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000916
Family Terminase gpNU1 subunit domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 247156.nfa15120
Sequence length 83
Comment (Nocardia farcinica IFM10152)
Sequence
MEGVSSFPGGDMAAVLVTDGLDSKLTAVEASAIFSVTAATIRKWASLGKLAAVGMDARNR
KLYRLADIAACEKATRHAAGRGR
Download sequence
Identical sequences A0A2A7U8F1 Q5YZN4
247156.nfa15120 WP_011208042.1.78782 gi|54023479|ref|YP_117721.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]