SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 247156.pnf1540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  247156.pnf1540
Domain Number 1 Region: 527-740
Classification Level Classification E-value
Superfamily beta-carbonic anhydrase, cab 1.44e-54
Family beta-carbonic anhydrase, cab 0.00033
Further Details:      
 
Weak hits

Sequence:  247156.pnf1540
Domain Number - Region: 435-500
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0432
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 247156.pnf1540
Sequence length 756
Comment (Nocardia farcinica IFM10152)
Sequence
MSQAEAPESADDLHTSPSSPSRDRLRGILRHDLPSSVVVFLVALPLSLGIAIASDAPIMA
GLIAAVIGGIVAGAVGGSPMLASGPAAGLTVVVAELVAKFGWQVTCAITVAAGALQILFG
LSRIARAALAISPVVVHAMLAGIGITIALQQVHVLLGGTSRSSVWQNLSQLPAQLTRLHW
GDLTIGLIVIVTLLSWKKVPGALGRIPGALVAVVAATAVSLVVPLGVERIVMNGSLFDAI
ALPALPDGKWLAVATGVLTVALIASVESLLSAVAVDKMHSGARTDLNRELIGQGTANIAS
GMLGGLPITGVIVRSATNVAAGAKSKASTILHGVWILLFSVLLAGVVQQIPKAALAGLLI
VIGIQLVKLAHIRLAHRTGDLWVYLITVAGVMFLNLLEGVLIGLIVAIALFVWRAARADI
HAEPVGDLDSLRWRVVIEGSCSFLSLPKLSSTLDSVPEGADVTIELTVDFIDHAATEVLH
EWQRRHRDAGGTVLIDELGSHALSATTQGPPQRASSAQARGVEPWKAWQDTNAQAVPHFD
ALRPMLDGISRYHRRHAPLMRAHLSELRDRQDPTTFFLTCGDSRVVPNLITHSGPGDLFT
IRNIGNLIPSDGLDTSVDAALAFAVEELGVSTIVVCGHSGCGAMGALLGKPTKNSPAVRD
WLAHAEPSLRAYHDNHPVAAAAEAAGFDAYDQLAIVNVAVQIATATQHPSLVSAVAQGQV
QIVGLFFDIATATVWHVSPTTVTAHHNQLATSTVHA
Download sequence
Identical sequences Q5YML1
247156.pnf1540 gi|54027703|ref|YP_121944.1| gi|54027703|ref|YP_121944.1|NC_006362 WP_011212262.1.78782 WP_011212262.1.98152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]