SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 251221.gll0323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  251221.gll0323
Domain Number - Region: 84-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00385
Family Sfri0576-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.gll0323
Sequence length 144
Comment (Gloeobacter violaceus)
Sequence
MLTVDEQKHPIYYLLFDGTPTAQDTEAHLASWERWLSEGESFGVIQRQVGVEAGEGKPPK
EGHKLEVDFFRRNRPRIAGLCFGVAVVLDSEAMLDKWQPLAAKAIENMVGCTGRAFGTVA
EAVQWLEERQIAAPPIEAAPGEHR
Download sequence
Identical sequences Q7NNT6
251221.gll0323 NP_923269.1.44878 gi|37519892|ref|NP_923269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]