SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gsr3505 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  251221.gsr3505
Domain Number - Region: 3-48
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00267
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gsr3505
Sequence length 99
Comment (Gloeobacter violaceus)
Sequence
MAQVLKTRQAERDIEDIWFYIALEDLQAADRWLEGMSAQAQLVASQPRMGRVRPELGTEI
RSFAAGRYVLFYRPLPDGIELVRVLHGARDLDALFGGDL
Download sequence
Identical sequences Q7NFL9
251221.gsr3505 NP_926451.1.44878 gi|37523074|ref|NP_926451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]