SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gvip070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gvip070
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily GlnB-like 5.4e-39
Family Prokaryotic signal transducing protein 0.0000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.gvip070
Sequence length 122
Comment (Gloeobacter violaceus)
Sequence
MNKIEAIIQPSRLDAVEQALAAIGVQGMTVSRVEGFGRQRGHSVIFRGFGSAAQFLAKLK
LEIVVPDEFTETVVERIVQAARTGSVGDGKIFVLPVTQAVRVRTGECDLEAVRFESPAVL
IH
Download sequence
Identical sequences Q7NMS6
251221.gvip070 NP_923635.1.44878 gi|37520258|ref|NP_923635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]