SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 255470.cbdb_A573 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  255470.cbdb_A573
Domain Number 1 Region: 140-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.41e-130
Family Enolase 0.0000000356
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.39e-54
Family Enolase N-terminal domain-like 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 255470.cbdb_A573
Sequence length 428
Comment (Dehalococcoides CBDB1)
Sequence
MSAEVKSIKAREILDSRGNPTVEADVVLSDGSFGRAAVPSGASTGSHEAVELRDGDKSRY
NGLGVHKAVANVNTSIASAISGFKASDQQGLDNLLIELDGTPNKAKLGANAMLATSLAVA
HAAAASRHMPLYRYLNNSEEYILPVPMFNILNGGKHASNSTDFQEFMVMPVGAKSFAQAL
QMGTEVYHSLKKVLKGMNQNTTVGDEGGFAPSLPTNKDAVEVILKAIEKAGYRPGEDIFI
ALDPASSELYQDGKYTLATENKTLSSAEMVDYWCGWVEKYPIISIEDGLFEDDWDGWKLL
TRKIGNKVQLVGDDFYVTNIKRLDRGIKEKASNSILIKLNQIGTLSETIAAIKMANNAGW
TAVVSHRSGETEDTTIADLAVAMNAGQIKTGAPCRSERTAKYNRLLRIEEELGGKAKYPG
KDAFLNLK
Download sequence
Identical sequences A0A142V9T0 Q3ZX11
gi|73748433|ref|YP_307672.1| 255470.cbdb_A573 WP_011309107.1.74482 WP_011309107.1.89941 WP_011309107.1.91135 WP_011309107.1.92458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]