SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 255470.cbdb_A830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  255470.cbdb_A830
Domain Number 1 Region: 28-91
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000955
Family NfeD domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 255470.cbdb_A830
Sequence length 96
Comment (Dehalococcoides CBDB1)
Sequence
MSWYWIASLIVIVVLIIIFVVNQVVSAHLKQAATGKEELYGKKALVKTPLNPEGKVLYDG
EIWSAHIENGSAEVGQEVVIVRLEGLKLYVKMERSE
Download sequence
Identical sequences A0A2J1DXK6
2013897057 WP_011309325.1.17753 WP_011309325.1.48192 WP_011309325.1.55841 WP_011309325.1.66924 WP_011309325.1.74482 WP_011309325.1.75083 WP_011309325.1.79047 gi|452203636|ref|YP_007483769.1| gi|73748651|ref|YP_307890.1| gi|289432676|ref|YP_003462549.1| 255470.cbdb_A830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]