SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 255470.cbdb_B16 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  255470.cbdb_B16
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.32e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 255470.cbdb_B16
Sequence length 190
Comment (Dehalococcoides CBDB1)
Sequence
MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNN
PIRERSGINQPDIVVVLDPSLVIIGNVISGLKDGGTLIINTTKPLEHFASQYGDRWKVAT
VDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPLKHRFGKLAAKNMAAMKKAFE
ETVVKELKVG
Download sequence
Identical sequences A0A142V9D5
gi|73748520|ref|YP_307759.1| WP_011309194.1.17753 WP_011309194.1.45256 WP_011309194.1.48192 WP_011309194.1.52557 WP_011309194.1.55841 WP_011309194.1.5855 WP_011309194.1.62194 WP_011309194.1.66924 WP_011309194.1.67918 WP_011309194.1.74482 WP_011309194.1.75083 WP_011309194.1.79047 WP_011309194.1.83924 WP_011309194.1.84634 WP_011309194.1.89941 WP_011309194.1.91135 WP_011309194.1.92458 gi|147669301|ref|YP_001214119.1| gi|452203524|ref|YP_007483657.1| gi|452204960|ref|YP_007485089.1| 216389.DehaBAV1_0656 255470.cbdb_B16 gi|289432567|ref|YP_003462440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]