SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 257309.DIP1277 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257309.DIP1277
Domain Number 1 Region: 82-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000131
Family NfeD domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 257309.DIP1277
Sequence length 144
Comment (Corynebacterium diphtheriae)
Sequence
MGSLEWFVISVALVVLELFIGELTFFMLGLAAICAAGVGLVTDNVALQAAAFSVSAISLL
LFLKPLIKKHFELPTSLELTPRALIGMSGEVVKKITEHSGQIKLDGSIWSARSLDPAVNF
QTGQSVCVVEIDGPTAVVWKESKT
Download sequence
Identical sequences Q6NH69
257309.DIP1277 gi|38233862|ref|NP_939629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]