SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 257310.BB1399 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  257310.BB1399
Domain Number - Region: 37-91
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0916
Family DNA-binding N-terminal domain of transcription activators 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257310.BB1399
Sequence length 93
Comment (Bordetella bronchiseptica)
Sequence
MTDKHETLREAADRLNSARRAFGLGEDGLRLLRRSREAFINSLRNTGLTYAQAQVKYDNC
LDEQQQLHQQAIHELQYAERLHRQLLAELEQTA
Download sequence
Identical sequences A0A0H3LPJ5 A0A261VIC3 A0A2J9U1C3 Q7WB26
gi|33600385|ref|NP_887945.1| WP_003809483.1.14246 WP_003809483.1.15674 WP_003809483.1.1660 WP_003809483.1.17334 WP_003809483.1.17359 WP_003809483.1.19828 WP_003809483.1.21837 WP_003809483.1.23657 WP_003809483.1.24339 WP_003809483.1.26498 WP_003809483.1.27032 WP_003809483.1.29688 WP_003809483.1.32589 WP_003809483.1.37794 WP_003809483.1.38534 WP_003809483.1.40806 WP_003809483.1.50287 WP_003809483.1.58338 WP_003809483.1.60706 WP_003809483.1.63299 WP_003809483.1.63717 WP_003809483.1.64622 WP_003809483.1.66177 WP_003809483.1.69310 WP_003809483.1.71104 WP_003809483.1.71382 WP_003809483.1.72041 WP_003809483.1.72302 WP_003809483.1.78117 WP_003809483.1.82471 WP_003809483.1.82663 WP_003809483.1.84976 WP_003809483.1.86585 WP_003809483.1.87218 WP_003809483.1.88542 WP_003809483.1.91389 257310.BB1399 257311.BPP1183 gi|33595856|ref|NP_883499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]