SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 257311.BPP1390 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257311.BPP1390
Domain Number 1 Region: 127-377
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.08e-57
Family D-glucarate dehydratase-like 0.00047
Further Details:      
 
Domain Number 2 Region: 12-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.61e-25
Family Enolase N-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 257311.BPP1390
Sequence length 382
Comment (Bordetella parapertussis)
Sequence
MTRDAAPITPARVRAHVFRYPVSTPVKTSFGTMHDRPAVLVEVEDSDGAVGWGEVWCNFP
ACGAEHRARLVETVLAPLLTARAFADPAQAFAHLEARTAVLAIQTGEPGPLAQAIAGLDI
ALCDLAARRAGEPLWAWLGGSGDRIGVYASGINPENPEDVVARKAAEGYRAFKLKVGFDD
ARDVRNALHVRELLGAATPLMADANQGWDLPRARQMAQRLGPAQLDWLEEPLRADRPAAE
WAELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLAKWGGFSGCLPVARAVVAAG
LRYCPHYLGAGIGLQASAHLLAAVPGLASPGLLEVDANDNPLRSLLSPALATLHEGRITL
GGAPGLGVTPDLAALRAACAAR
Download sequence
Identical sequences A0A2J9U0U1 Q7WAI7
WP_010928012.1.23657 WP_010928012.1.26498 gi|33596047|ref|NP_883690.1| NYSGXRC-9284c 257311.BPP1390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]