SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 257311.BPP3979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257311.BPP3979
Domain Number 1 Region: 765-969
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 2 Region: 53-238
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-20
Family Pyruvate oxidase and decarboxylase Pyr module 0.043
Further Details:      
 
Domain Number 3 Region: 481-664
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000118
Family Pyruvate oxidase and decarboxylase PP module 0.03
Further Details:      
 
Weak hits

Sequence:  257311.BPP3979
Domain Number - Region: 310-385
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00651
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.04
Further Details:      
 
Domain Number - Region: 669-723
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0468
Family Ferredoxin domains from multidomain proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 257311.BPP3979
Sequence length 1224
Comment (Bordetella parapertussis)
Sequence
MPLPHKGLSAWLVRTPLTNGVDMNAPLTPAQRAALESVHLDDKYTLTAGRAWMSGIHALV
RLPMMQRVRDERAGLNTAGFVSGYRGSPLGGVDQNMWKAAKYLKQHHIEFQPGINEDLAA
TAVWGSQQVNLFPGAKYDGVFGMWYGKGPGVDRCGDVFKHANAAGTSRHGGVLVVAGDDH
PAKSSTLPHQSDHILKACMIPALFPASVQEVLDYGLHGWAMSRYAGVWVGMKCITDIVEV
SASVEVDPERTRIVLPEDFQLPPDGLNIRLPDTPLQQEARLLDYKLYAALAYARANRLNR
EMWQVPNAQARFGIMTSGKAYLDTRQALADLGLSEEICKRIGLRLFKVGMVWPLEATGMQ
RFAEDLDEILVVEEKRQVLEYQLKEELFSWIGTGKKIPRVVGKFDDKDGGEWSVPQGNWL
LPAHYEFSPAMVAKAIGARLLRFELPEDVRAGIQARLDFIAEREQALARPRLVVDRKPWF
CSGCPHNTSTRVPEGSRGMAGIGCHYMVTWMGRNTQVFTQMGGEGVPWVGQAPFTEEKHV
FANLGDGTYYHSGLLAIRAAVAAKVPITYKILFNDAVAMTGGQPVDGPISVPMITRQMAA
EGIEKIVVVTDEPEKYRHVTDLAPGVPVKHRDELDAVMKELRAYPDVSVLVYDQTCATEK
RRRRKRNAYPDPALRVVINERVCEGCGDCSEKSHCLSVEPLETEFGRKRTINQSSCNKDY
SCLKGFCPSFVTVEGGRLRKPRALAQQDAIDQGLPAPRADALAGHYGVFIAGVGGTGVVT
IGQLLGMAAHLEGKGCSVLDMAGLAQKGGAVYSHVVLAPTPGELLNTRVAMGEADLVLAG
DLVVGTSPEAIARMRPGRTHTLLNSDVAPTAAFVHDPDWTLPGSNLQADLAKACGADNVA
TIDAAELAVGLLGDAIYANPLMMGYAYQKGWLPLGEAAMQRAIELNGQQVENNLAAFAWG
RRAAHDLAQVQALIGKGQPAAGDEGIVEVKRGQGAVVDFKRPAGELGALARIRRAFLAQY
QNEAYARRYQDLVDQVAAAEQAATGTTRLAEAVARYYFKLMAYKDEYEVARLYSDGEFLK
RIDAQFEGDWKLNFHLAPPLFSKRDSEGHLVKRRYGPATLRLFGALARLRFLRGTAFDVF
GYTAERRAERALIEQYREQLGAILPKLNRGNLEHAVALASLPEEIRGYGHIKEAAMARAD
VRRAELMREFSASVVPIGGGVRAA
Download sequence
Identical sequences Q7W3Q1
gi|33598483|ref|NP_886126.1| 257311.BPP3979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]