SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 257314.LJ1416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  257314.LJ1416
Domain Number 1 Region: 140-420
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.63e-104
Family Enolase 0.000000342
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.5e-51
Family Enolase N-terminal domain-like 0.00000652
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 257314.LJ1416
Sequence length 428
Comment (Lactobacillus johnsonii NCC 533)
Sequence
MLKSVIENVHALEIFDSRGNPTVEVFVTLSNGVVGKAEVPSGASTGENEAVELRDGGSRL
GGKGVMNAVNNVNTEINDALKGLDPHDQPNIDATMIALDGTPNKGRLGANAILGVSMATA
AAAAKDNHQPLYRYLGGTDLEMPQTFHNVINGGEHADNGIDIQEFMITPVAKTSFRDGFE
KIVNVYHTLKKVLEDMGYETGLGDEGGFAPNMKNSEEALKALHESIIKAGYKPGEDIAIA
CDCAASYFYNKEDGKYHLEGKVLTDEELADYYDKLLDEFPELISMEDPYDENDVEGMVKF
TQSHKDRIQIVLDDFICTNPKLLNKAIHEGAGNASLIKLNQIGTVTETLETIRLSRKNGY
NTMISHRSGETGDTFIADFAVAVNGGQLKTGAPARSERVEKYNRLLEIEEELGKGERLAF
FPDNVDLD
Download sequence
Identical sequences A3F8V7 D0R3R0 F4AC97 F7SDW4 Q74IV0 V5P3D6
gi|42519286|ref|NP_965216.1| gi|268319334|ref|YP_003292990.1| 257314.LJ1416 633699.FI9785_851 gi|385825756|ref|YP_005862098.1| WP_004897160.1.10084 WP_004897160.1.13362 WP_004897160.1.24787 WP_004897160.1.27409 WP_004897160.1.27769 WP_004897160.1.28348 WP_004897160.1.28407 WP_004897160.1.40168 WP_004897160.1.43572 WP_004897160.1.46682 WP_004897160.1.54950 WP_004897160.1.56141 WP_004897160.1.58924 WP_004897160.1.63737 WP_004897160.1.64510 WP_004897160.1.65350 WP_004897160.1.77592 WP_004897160.1.86701 gi|560152076|ref|YP_008844910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]