SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 257314.LJ1770 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  257314.LJ1770
Domain Number - Region: 15-99
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00942
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 257314.LJ1770
Sequence length 338
Comment (Lactobacillus johnsonii NCC 533)
Sequence
MNKKHFIGMLIVLLISGFVIWQELRKTPIKALWGASKKLNLTFLLLVLLVMVLSYVCEAA
IIWILEHKKGDPHRSAWSFFRIPIIQALFNAITPLSTGGQPSQLVAMIQMGIEGGRATSI
LLMKFIIYQICVLFAYVSTIIFGFHMVVTKFSGLALFILIGFILHVSSIIFLLAIMFAYR
WTKNTTNWLMDLLEKFMNKNTVEKWRKNTMEKIETFYAEGQNLKREKKKLLGASILTIGQ
LLCFYSIPYLILLALNLTPSWLDVTQMNIMIIMFMAIVPIPGASGGAEFSFQTLFSTFIH
SNILLTLGMFLWRFTTYFFGMILWIFGWLFKPKKVKSH
Download sequence
Identical sequences Q74HZ9
WP_011162436.1.27409 257314.LJ1770 gi|42519645|ref|NP_965575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]