SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 258594.RPA0877 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  258594.RPA0877
Domain Number - Region: 91-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00536
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 258594.RPA0877
Sequence length 149
Comment (Rhodopseudomonas palustris CGA009)
Sequence
MTAILTALGAWNWLILGLVLMALELLAPGVFLFWLGLAALLVGVLALLLEPGWQLQILLF
GLFAAAAVPLWRRMARGGDVEVHATNPFLNRRTDALVGREFTLEKPIEGGVGTVRIDDTV
WRVSGPDTPAGSRIRIVAADGVTLTVAAL
Download sequence
Identical sequences Q6NBF1
WP_011156412.1.60452 WP_011156412.1.81860 gi|39933954|ref|NP_946230.1| 258594.RPA0877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]