SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 258594.RPA1228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  258594.RPA1228
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 258594.RPA1228
Sequence length 186
Comment (Rhodopseudomonas palustris CGA009)
Sequence
MSTSRIELRFGGTGGQGLLLSAKLLADALAVEGRHVAQSQTYEPTSRGGFCNADLVVAHG
EVDYPLPIEFDHLVLLDKIAIKPSWPKLKAGALVISDVRLCPELPEGGRFKRYPLPLSRT
AIELGSERVTNIVALGVLIELSGICKHKSVEQVVRASSPRGFLDLNMDALAAGYALAKTP
AVAAAS
Download sequence
Identical sequences Q6NAF7
258594.RPA1228 WP_011156792.1.60452 WP_011156792.1.81860 gi|39934303|ref|NP_946579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]