SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_0544 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  259564.Mbur_0544
Domain Number - Region: 15-64
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0366
Family C1-like domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_0544
Sequence length 171
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MNIPATTKYTYDLKKKTLHIEHQILAVDSEENEVGTCSKCRSPIVSLSYHAIDKEFIIVG
KCTKCEKLTANIYDQDWNWVSEIPNSHFSRYVAKAGTSTPMKNEVEVDQKLSGLALLESI
PEKQLHSVFSATEITAMFARAKGESCVRQYLYNARKKYQKFEDIFGFIIEV
Download sequence
Identical sequences Q12YF5
WP_011498683.1.71292 gi|91772579|ref|YP_565271.1| 259564.Mbur_0544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]