SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_0761 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_0761
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.59e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_0761
Sequence length 199
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MKFDIIIAGVGGQGVVLASRLLATAAMNASFHVTTAETIGMAQREGSVTSHVRIGDEVCG
SLIPSGNADLIIGLEPAETARNLHFLGNGGSIIVNEHAVMPSVNGSVKYDPEQVLEFLKA
NCQEIISFDFTQLAKQAGTYRAANVAMLAAVAGTDLLPFTPDDLWNVLEKMVPEKYRDVN
RRAFDMAFERVSSIKKPEQ
Download sequence
Identical sequences Q12XV4
WP_011498877.1.71292 259564.Mbur_0761 gi|91772780|ref|YP_565472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]