SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_1132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_1132
Domain Number 1 Region: 8-195
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_1132
Sequence length 196
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MSSKASKFDLVISGVGGQGAILASDIIGKSAVLENYGVRAAETHGMAQRGGSVVNHIRIG
CDLGSMIPLKGADCLLALEPVEALRYIDSLADDGVVIMNTEAVYPVTVNTGKAEYPDVES
IVAELKKTHRVIAFNATEKAAEAGSRQAMNVVLVGAVSNFLPIKTETLLNRVKEMVPPKT
IDTNVKAFEMGRSMVE
Download sequence
Identical sequences Q12WW9
gi|91773115|ref|YP_565807.1| WP_011499204.1.71292 259564.Mbur_1132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]