SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_1310 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_1310
Domain Number 1 Region: 228-367
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.51e-33
Family Potassium channel NAD-binding domain 0.00076
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.78e-29
Family Potassium channel NAD-binding domain 0.00089
Further Details:      
 
Domain Number 3 Region: 135-219
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 9.68e-17
Family TrkA C-terminal domain-like 0.0051
Further Details:      
 
Domain Number 4 Region: 369-443
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.00000000000641
Family TrkA C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_1310
Sequence length 444
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MKIIIVGAGEVGFHIASSLYLNNDVVVIDIDEDACARADELDVQVIQGNGANVSILERLI
NDADLLVAVTGSDELNIVTCTTAKLISPLHKQLKTMARVTNPDYIDRPVATRTQVGIDVM
ICPELALASEVAEILSMPSAIDAEVFADGKVKMMEFVVSDESDLVDKKMKDLDISECCIV
SALYRDSNIIIPHGDDVIHKGDHVVVIGKSDAMMDIGNLFAGHTDNVKRVLIIGGGTVGF
YLAKLLEKSNTSIKIIEKNLDRCESIADLLPKVLVLKGNGTDIHLLKEEGVQNMDVVISV
TDSDEKNLLCALLSKQLGAKKVIVRADHLDYVPLFELVGVDRAVSPREATINEVLKLTMG
TGIEALTMIEGEKAEIIEYNASSTSKVTGKPLKNVRFPEGALVCMVVHKGDTFVPRGNYI
IKEGDRVLVFLLPSAHQKVERLFK
Download sequence
Identical sequences Q12WE8
WP_011499373.1.71292 gi|91773286|ref|YP_565978.1| 259564.Mbur_1310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]