SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_1359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_1359
Domain Number 1 Region: 11-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000455
Family MarR-like transcriptional regulators 0.084
Further Details:      
 
Weak hits

Sequence:  259564.Mbur_1359
Domain Number - Region: 98-124
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00314
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_1359
Sequence length 262
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MIDILQSKSGITKFQILTEVAAHQPNVRQKEIAEKIGVTPQAVSEYIKELTAEGFIFSDG
RVRYRITKKGVEWVLEGAADMKRYANFVMSDIISHVSTWTAIADEDLEKGDDVYLQMRKG
LLYVSKTNITSATGITISSVEKGDDVGVTNLLGMIELETASITVCKIPRSERGGSRNVDL
ERLEKLASSKSFIAVIGVESLVALKKINKEPDVMYGAKESIVEAAFHGLSSLVLAIDEEV
PQIMSRLETENLEYELVDLNVQ
Download sequence
Identical sequences Q12W99
gi|91773335|ref|YP_566027.1| WP_011499422.1.71292 259564.Mbur_1359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]