SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_1803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_1803
Domain Number 1 Region: 11-193
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.67e-29
Family Clp protease, ClpP subunit 0.036
Further Details:      
 
Domain Number 2 Region: 371-433
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000275
Family NfeD domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_1803
Sequence length 437
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MILNKGSPILPFFFLVLLLLIPSVASAEQTVLVLDISDSITPVADDLVIDALQLAEQNEY
EALIITLNTPGGGVDETLKIIEAIDRSDIPVIGYVYPGGTKAWSAGTLILIGTDIAAMSP
NTIIGSAQPVSVSPQGIEPIEDDKIVNALVALAKTKAKQHGRNETTAEKFITENLNLNDE
EALEAGIIEYVASDIDDLLEQVNGQMIKGKVLNTKGAAIENYRPSLRLSFMDIISDPIIS
SLLIMLGIYGIVIGISNPGAGAEIFGIVAISLGLVGMGFDVNIAAIFLILLGVILFVLEL
QAPGFGIFGLAGLVCLIAGSIFLVPMDFPRWYSPADVQRSMIIAIVTPTIVMGILFVFVF
YKVLEVRHKKPVIGEDPIGEMANAIEDIKAGEEGFVKYKGEYWKAKVEEEISDGDKVEIT
DVQGPLFTVKKIEEEGE
Download sequence
Identical sequences Q12V37
WP_011499832.1.71292 gi|91773747|ref|YP_566439.1| 259564.Mbur_1803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]