SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_2189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_2189
Domain Number 1 Region: 435-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_2189
Sequence length 550
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MRTEQKVKNYFEESFLSDLKAGLITAVVALPLAIAFAIASGVEPVMGLYTAIIAGMLVST
FGGSRYSISGPTGAMTVIVLSTVNGYGVEGLLLAGVLAGVFQILFGIFRLGKVVKYIPLP
VISGFTSGIGIIILIGQLSNVFGLVLPAREHVWETVYDVFTSIDAMNILALSMFAGTIIL
MLLLPKVLSNIKYLKNIPASIITLVLSVILTYHFDLKIPIVGEIPSIIPQIHMLDINIGL
MYAVLPAAFTIALLGTIESLLCAVVCDAMTNTKHNSNKELIGQGIANVILPFFAGIPATA
AIARSAVNIREGAKTRMSGVIHALVLLGILIFFGPIAQYIPKAYLAGILVLVSIKMVNVD
EIRTTINISKMDTFVLLTTFALTVLTDLVFAIQAGMFLSIILLFIRLTNIIDVQSMEGYD
PSEGINATILSDPYLKDNVAVYTINGPFFFGAMAVFENKVDEHIHMSKPHIIIRMRYVPF
IDTTGIERLKSFITTRKGTGEKVYLTTVQPEVMRSINSDTVLSKLMQEKDVIVFKSTQEA
LGYLQEREGN
Download sequence
Identical sequences Q12U22
259564.Mbur_2189 gi|91774112|ref|YP_566804.1| WP_011500190.1.71292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]