SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 260799.BAS3623 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  260799.BAS3623
Domain Number 1 Region: 196-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.26e-73
Family PFOR Pyr module 0.022
Further Details:      
 
Domain Number 2 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.003
Further Details:      
 
Domain Number 3 Region: 468-576
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.23e-24
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 260799.BAS3623
Sequence length 585
Comment (Bacillus anthracis str Sterne)
Sequence
MISQLSWKVGGQQGEGIESTGEIFCIALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTE
VRAISDDLDILIAFDQETIDFNFHELRPGGIVVADAKFNPTIPDNTDVNLYVIPFTDIAS
ELGTSLMKNMVAVGASSAVLGLDETAYLDVVEEIFGRKGEQVVQKNMDAIKRGSQYMKEL
LGEKVNMMQLEKADGQKRMFMIGNDAIAFGAVAGGARFMSAYPITPASEIMEYLIKKLPK
VGGTVIQTEDEIAACTMAIGANYAGVRTLTASAGPGLSLMMEAIGLAGITETPLVIVDTQ
RGGPSTGLPTKQEQSDLMAMIYGTHGEIPKIVMAPSTVEEAFYDIVEAFNLSEEYQVPVI
FLTDLQLSLGKQTVEPLKLDKVEIRRGKLDLEAELPERENKAYFKRYEVTEDGVSPRVLP
GMKNGVHHVTGVEHDETGKPSESALNRKDQMDKRFRKMENLKFNTPVYKNVKHEEADVLL
VGFNSTRGAIEEAMERLEQEGMKVNHAHVRLIHPFPTAEIDPLVKKAKRVVVVENNATGQ
LANIMKMNLGNGEKISSLLKYDGNPFLPKEIYNECKKGVVLNGNI
Download sequence
Identical sequences A0A0B5NTL5 A0A0F7RDW7 A0A0G8DGF3 A0A242W913 A0A243CPZ9 B7JJ52 C3G6S5 C3GMM9 D8H7W8 Q81WQ8
gi|30263780|ref|NP_846157.1| gi|229603986|ref|YP_002868016.1| gi|301055264|ref|YP_003793475.1| gi|47529201|ref|YP_020550.1| NP_846157.1.87267 WP_000625423.1.100059 WP_000625423.1.100214 WP_000625423.1.100409 WP_000625423.1.100595 WP_000625423.1.101931 WP_000625423.1.10208 WP_000625423.1.11387 WP_000625423.1.11427 WP_000625423.1.11676 WP_000625423.1.13115 WP_000625423.1.13820 WP_000625423.1.14721 WP_000625423.1.14855 WP_000625423.1.15163 WP_000625423.1.15460 WP_000625423.1.15569 WP_000625423.1.16156 WP_000625423.1.16170 WP_000625423.1.16997 WP_000625423.1.17146 WP_000625423.1.18976 WP_000625423.1.19258 WP_000625423.1.19435 WP_000625423.1.19445 WP_000625423.1.20390 WP_000625423.1.20680 WP_000625423.1.21021 WP_000625423.1.21258 WP_000625423.1.22865 WP_000625423.1.23269 WP_000625423.1.23615 WP_000625423.1.2419 WP_000625423.1.24334 WP_000625423.1.24556 WP_000625423.1.24608 WP_000625423.1.25316 WP_000625423.1.25716 WP_000625423.1.25752 WP_000625423.1.2618 WP_000625423.1.26665 WP_000625423.1.26721 WP_000625423.1.27644 WP_000625423.1.27987 WP_000625423.1.28427 WP_000625423.1.28729 WP_000625423.1.29101 WP_000625423.1.29787 WP_000625423.1.30110 WP_000625423.1.30216 WP_000625423.1.31490 WP_000625423.1.3236 WP_000625423.1.32576 WP_000625423.1.33175 WP_000625423.1.33338 WP_000625423.1.33367 WP_000625423.1.33536 WP_000625423.1.33740 WP_000625423.1.33876 WP_000625423.1.34646 WP_000625423.1.35684 WP_000625423.1.35886 WP_000625423.1.36305 WP_000625423.1.36763 WP_000625423.1.38036 WP_000625423.1.39781 WP_000625423.1.41165 WP_000625423.1.41675 WP_000625423.1.42217 WP_000625423.1.4439 WP_000625423.1.45305 WP_000625423.1.45533 WP_000625423.1.46236 WP_000625423.1.46549 WP_000625423.1.46699 WP_000625423.1.47145 WP_000625423.1.4763 WP_000625423.1.47644 WP_000625423.1.47798 WP_000625423.1.51749 WP_000625423.1.53137 WP_000625423.1.53493 WP_000625423.1.53683 WP_000625423.1.53879 WP_000625423.1.54117 WP_000625423.1.54189 WP_000625423.1.55811 WP_000625423.1.55968 WP_000625423.1.56042 WP_000625423.1.56176 WP_000625423.1.56270 WP_000625423.1.56318 WP_000625423.1.56580 WP_000625423.1.58160 WP_000625423.1.59095 WP_000625423.1.59173 WP_000625423.1.59310 WP_000625423.1.59575 WP_000625423.1.60402 WP_000625423.1.61213 WP_000625423.1.63560 WP_000625423.1.63611 WP_000625423.1.64491 WP_000625423.1.66357 WP_000625423.1.67239 WP_000625423.1.68607 WP_000625423.1.69203 WP_000625423.1.69822 WP_000625423.1.69894 WP_000625423.1.70065 WP_000625423.1.7096 WP_000625423.1.70996 WP_000625423.1.71895 WP_000625423.1.72704 WP_000625423.1.73325 WP_000625423.1.74226 WP_000625423.1.74538 WP_000625423.1.7545 WP_000625423.1.75499 WP_000625423.1.75870 WP_000625423.1.76125 WP_000625423.1.76783 WP_000625423.1.77668 WP_000625423.1.77824 WP_000625423.1.78644 WP_000625423.1.79315 WP_000625423.1.79584 WP_000625423.1.80695 WP_000625423.1.81799 WP_000625423.1.82289 WP_000625423.1.83951 WP_000625423.1.84045 WP_000625423.1.85689 WP_000625423.1.85901 WP_000625423.1.86119 WP_000625423.1.86140 WP_000625423.1.86239 WP_000625423.1.86288 WP_000625423.1.8698 WP_000625423.1.8825 WP_000625423.1.88641 WP_000625423.1.90155 WP_000625423.1.90596 WP_000625423.1.90791 WP_000625423.1.92686 WP_000625423.1.92831 WP_000625423.1.93271 WP_000625423.1.93744 WP_000625423.1.93893 WP_000625423.1.93927 WP_000625423.1.94237 WP_000625423.1.94322 WP_000625423.1.94784 WP_000625423.1.95308 WP_000625423.1.96934 WP_000625423.1.97781 WP_000625423.1.97861 WP_000625423.1.98216 WP_000625423.1.99445 WP_000625423.1.99485 WP_000625423.1.99994 YP_029876.1.16718 gi|386737597|ref|YP_006210778.1| 198094.BA_3910 260799.BAS3623 261594.GBAA3910 405535.BCAH820_3786 568206.BAMEG_0721 592021.BAA_3935 gi|227813318|ref|YP_002813327.1| gi|49186624|ref|YP_029876.1| gi|218904902|ref|YP_002452736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]