SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 261594.GBAA0653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  261594.GBAA0653
Domain Number 1 Region: 387-472
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000706
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 261594.GBAA0653
Sequence length 483
Comment (Bacillus anthracis Ames 0581)
Sequence
MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVGLYAAFCIAVTISFVG
GRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFGVFKLSSFMKFVPKSVM
SGFLNALGILVFTAQLPQLKNATWQMYALVALGLAIIYVFPRITTAVPSTLIAIIIVTSI
ALMSGLQLKTVGDMGSLPKELPFFSIPDVPFTLETLGIILPYAVMLAIIGLLESLLTASV
LDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSVINIKSGGRGRLSTFVAGGF
LIVLLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVATIHKVPKGNAFVMIVTVVVVLI
THNLGLGVVIGTVISAVLFAFNMAKIHVKHLYIENKKIYEIHGQLFFASTADFINNFSFN
EDVKEIEMNFTHAHVWDDSAVASIDKVIMKYEQSGVKVSITGLNERSAKLVTNLATYNKR
IAS
Download sequence
Identical sequences A0A0F7RLX2 Q81V48
gi|30260806|ref|NP_843183.1| gi|47777841|ref|YP_017282.2| gi|229604301|ref|YP_002865250.1| gi|49183646|ref|YP_026898.1| NP_843183.1.87267 WP_000487882.1.100595 WP_000487882.1.10208 WP_000487882.1.11427 WP_000487882.1.11676 WP_000487882.1.13115 WP_000487882.1.13233 WP_000487882.1.13820 WP_000487882.1.14721 WP_000487882.1.14855 WP_000487882.1.15460 WP_000487882.1.15569 WP_000487882.1.16170 WP_000487882.1.16997 WP_000487882.1.17146 WP_000487882.1.19258 WP_000487882.1.19435 WP_000487882.1.19445 WP_000487882.1.20390 WP_000487882.1.20680 WP_000487882.1.21021 WP_000487882.1.21258 WP_000487882.1.21776 WP_000487882.1.22865 WP_000487882.1.23269 WP_000487882.1.2419 WP_000487882.1.24556 WP_000487882.1.24608 WP_000487882.1.25716 WP_000487882.1.25752 WP_000487882.1.2618 WP_000487882.1.26665 WP_000487882.1.27644 WP_000487882.1.27987 WP_000487882.1.28427 WP_000487882.1.28729 WP_000487882.1.29101 WP_000487882.1.29787 WP_000487882.1.30110 WP_000487882.1.31490 WP_000487882.1.3236 WP_000487882.1.33175 WP_000487882.1.33338 WP_000487882.1.33367 WP_000487882.1.33740 WP_000487882.1.33876 WP_000487882.1.34646 WP_000487882.1.35684 WP_000487882.1.35886 WP_000487882.1.36305 WP_000487882.1.36763 WP_000487882.1.38036 WP_000487882.1.39781 WP_000487882.1.40550 WP_000487882.1.41165 WP_000487882.1.41675 WP_000487882.1.4439 WP_000487882.1.45305 WP_000487882.1.45533 WP_000487882.1.46236 WP_000487882.1.46699 WP_000487882.1.47145 WP_000487882.1.4763 WP_000487882.1.47644 WP_000487882.1.47798 WP_000487882.1.51749 WP_000487882.1.52794 WP_000487882.1.53137 WP_000487882.1.53493 WP_000487882.1.53683 WP_000487882.1.54117 WP_000487882.1.54189 WP_000487882.1.55811 WP_000487882.1.55958 WP_000487882.1.56042 WP_000487882.1.56176 WP_000487882.1.56270 WP_000487882.1.56959 WP_000487882.1.58160 WP_000487882.1.59095 WP_000487882.1.59310 WP_000487882.1.59575 WP_000487882.1.60402 WP_000487882.1.63560 WP_000487882.1.68607 WP_000487882.1.69203 WP_000487882.1.69822 WP_000487882.1.69894 WP_000487882.1.70065 WP_000487882.1.70996 WP_000487882.1.73325 WP_000487882.1.74538 WP_000487882.1.75499 WP_000487882.1.75870 WP_000487882.1.76125 WP_000487882.1.76783 WP_000487882.1.77668 WP_000487882.1.77824 WP_000487882.1.79315 WP_000487882.1.79584 WP_000487882.1.80439 WP_000487882.1.80695 WP_000487882.1.81799 WP_000487882.1.82289 WP_000487882.1.83951 WP_000487882.1.84045 WP_000487882.1.85689 WP_000487882.1.86119 WP_000487882.1.86140 WP_000487882.1.86239 WP_000487882.1.86288 WP_000487882.1.8698 WP_000487882.1.8825 WP_000487882.1.88641 WP_000487882.1.90791 WP_000487882.1.90883 WP_000487882.1.9186 WP_000487882.1.92686 WP_000487882.1.92831 WP_000487882.1.93271 WP_000487882.1.93744 WP_000487882.1.93927 WP_000487882.1.94237 WP_000487882.1.94322 WP_000487882.1.94784 WP_000487882.1.96934 WP_000487882.1.97781 WP_000487882.1.97861 WP_000487882.1.98216 WP_000487882.1.99445 WP_000487882.1.99485 WP_000487882.1.99994 YP_026898.1.16718 198094.BA_0653 260799.BAS0621 261594.GBAA0653 568206.BAMEG_3934 592021.BAA_0736 gi|227816477|ref|YP_002816486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]