SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 261594.GBAA2850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  261594.GBAA2850
Domain Number 1 Region: 116-337
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.57e-63
Family D-glucarate dehydratase-like 0.00000459
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.69e-29
Family Enolase N-terminal domain-like 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 261594.GBAA2850
Sequence length 350
Comment (Bacillus anthracis Ames 0581)
Sequence
MKITDVKVNRRRVNLHTPFKTALRTVTEIESIDVYIHTDEGIVGKGAGAATPVITGDFAN
GIEEAILGPMRSSLIGQDIIQFQQLLQHIQMSCIGNPSAKAAVDIALYDVYCQYHNIPLY
ALLGGKKEIHTDITLSVDEPFIMAKEAKQHVEKGFQTLKIKVGKSAHLDLERIEAIRNSV
PKNTTLRLDANQGWNPKEAVSIIKEMENRNLNIEFIEQPVHAKDWDGLKYVKDHVQTPIM
ADESIFSASDALKIVQGRYVDLINIKLMKCSGIREAWRIADIAEAAGVKCMVGSMMESSL
SVSAVAHLAAAHPNIHYFDLDAPLWLMEEPEGMTYSGSKVNLQSTVNSKS
Download sequence
Identical sequences Q81PF7
NP_845194.1.87267 WP_000704575.1.100214 WP_000704575.1.100595 WP_000704575.1.10208 WP_000704575.1.11427 WP_000704575.1.11676 WP_000704575.1.13115 WP_000704575.1.13820 WP_000704575.1.14721 WP_000704575.1.14855 WP_000704575.1.15460 WP_000704575.1.15569 WP_000704575.1.16170 WP_000704575.1.16997 WP_000704575.1.17146 WP_000704575.1.18976 WP_000704575.1.19258 WP_000704575.1.19435 WP_000704575.1.19445 WP_000704575.1.20390 WP_000704575.1.20680 WP_000704575.1.21021 WP_000704575.1.21258 WP_000704575.1.21776 WP_000704575.1.22865 WP_000704575.1.23269 WP_000704575.1.2419 WP_000704575.1.24334 WP_000704575.1.24556 WP_000704575.1.24608 WP_000704575.1.25716 WP_000704575.1.25752 WP_000704575.1.2618 WP_000704575.1.26665 WP_000704575.1.26721 WP_000704575.1.27644 WP_000704575.1.27987 WP_000704575.1.28427 WP_000704575.1.28729 WP_000704575.1.29101 WP_000704575.1.29787 WP_000704575.1.30110 WP_000704575.1.31490 WP_000704575.1.3236 WP_000704575.1.32576 WP_000704575.1.33175 WP_000704575.1.33338 WP_000704575.1.33367 WP_000704575.1.33740 WP_000704575.1.33876 WP_000704575.1.34646 WP_000704575.1.35684 WP_000704575.1.35886 WP_000704575.1.36305 WP_000704575.1.36763 WP_000704575.1.38036 WP_000704575.1.39781 WP_000704575.1.41165 WP_000704575.1.41675 WP_000704575.1.4439 WP_000704575.1.45305 WP_000704575.1.45533 WP_000704575.1.46236 WP_000704575.1.46699 WP_000704575.1.4763 WP_000704575.1.47644 WP_000704575.1.47798 WP_000704575.1.51749 WP_000704575.1.52794 WP_000704575.1.53137 WP_000704575.1.53493 WP_000704575.1.53683 WP_000704575.1.54117 WP_000704575.1.54189 WP_000704575.1.55811 WP_000704575.1.55958 WP_000704575.1.56042 WP_000704575.1.56176 WP_000704575.1.56270 WP_000704575.1.58160 WP_000704575.1.59095 WP_000704575.1.59310 WP_000704575.1.59575 WP_000704575.1.60402 WP_000704575.1.61213 WP_000704575.1.63560 WP_000704575.1.68607 WP_000704575.1.69203 WP_000704575.1.69822 WP_000704575.1.69894 WP_000704575.1.70065 WP_000704575.1.70996 WP_000704575.1.72704 WP_000704575.1.73325 WP_000704575.1.74226 WP_000704575.1.74538 WP_000704575.1.75499 WP_000704575.1.75870 WP_000704575.1.76125 WP_000704575.1.76783 WP_000704575.1.77668 WP_000704575.1.77824 WP_000704575.1.78644 WP_000704575.1.79315 WP_000704575.1.79584 WP_000704575.1.80695 WP_000704575.1.81799 WP_000704575.1.82289 WP_000704575.1.83951 WP_000704575.1.84045 WP_000704575.1.85689 WP_000704575.1.86119 WP_000704575.1.86140 WP_000704575.1.86239 WP_000704575.1.86288 WP_000704575.1.8698 WP_000704575.1.8825 WP_000704575.1.88641 WP_000704575.1.90791 WP_000704575.1.9186 WP_000704575.1.92686 WP_000704575.1.92831 WP_000704575.1.93271 WP_000704575.1.93744 WP_000704575.1.93927 WP_000704575.1.94237 WP_000704575.1.94322 WP_000704575.1.94784 WP_000704575.1.96934 WP_000704575.1.97781 WP_000704575.1.97861 WP_000704575.1.98216 WP_000704575.1.99445 WP_000704575.1.99485 WP_000704575.1.99994 YP_028918.1.16718 gi|49185666|ref|YP_028918.1| gi|47528143|ref|YP_019492.1| gi|30262817|ref|NP_845194.1| gi|227814338|ref|YP_002814347.1| gi|229603731|ref|YP_002867120.1| 198094.BA_2850 260799.BAS2659 261594.GBAA2850 568206.BAMEG_1746 592021.BAA_2912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]