SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 261594.GBAA4296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  261594.GBAA4296
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.92e-31
Family Anti-sigma factor antagonist SpoIIaa 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 261594.GBAA4296
Sequence length 116
Comment (Bacillus anthracis Ames 0581)
Sequence
MSLSMQLEVKRDVLCVRLAGELDHHTAEELRTKVTDMIETHGVHHIVLSLENLSFMDSSG
LGVILGRYKHVKGLGGEMVVCAISPPVKRLFEMSGLFKIVRLEESEAHALATLGVA
Download sequence
Identical sequences A0A063CPF8 A0A0B5W6T9 A0A0F5RTM5 A0A0K6MMQ6 A0A0T8WC68 A0A158RI06 A0A1A9PZ22 A0A1H6BZW0 A0A1J9T823 A0A1J9VI71 A0A1J9YSG2 A0A1J9ZP38 A0A1J9ZY63 A0A1K0A2A6 A0A1V6LLK8 A0A229MXL6 A0A242W9T8 A0A242WSU8 A0A242YST0 A0A242YUS4 A0A243CEG0 A0A243CPS9 A0A243EFL5 A0A243GEZ0 A0A243I3P5 A0A243K8M9 A0A243N182 A0A243NTY0 A0A246PXB1 A0A246UCV0 A0A2B4NZK1 A0A2C9Z2P5 A0A2K1RTJ7 A0RI79 B3Z6V5 B3ZS02 B7HN54 B7JLS7 C2X279 F0PTY8 J8G5V9 J8GY44 J8KW47 J9A216 Q635K6 Q6HE92 Q731M2 Q81MF3 R8LK33
gi|49186983|ref|YP_030235.1| gi|218905212|ref|YP_002453046.1| gi|47778271|ref|YP_020939.2| gi|402555793|ref|YP_006597064.1| NP_846529.1.87267 WP_000059133.1.100059 WP_000059133.1.100095 WP_000059133.1.100214 WP_000059133.1.100241 WP_000059133.1.100409 WP_000059133.1.100595 WP_000059133.1.100684 WP_000059133.1.10069 WP_000059133.1.100771 WP_000059133.1.100873 WP_000059133.1.101140 WP_000059133.1.101309 WP_000059133.1.101550 WP_000059133.1.101720 WP_000059133.1.101843 WP_000059133.1.101931 WP_000059133.1.10208 WP_000059133.1.10762 WP_000059133.1.11044 WP_000059133.1.11060 WP_000059133.1.11380 WP_000059133.1.11387 WP_000059133.1.11427 WP_000059133.1.11676 WP_000059133.1.1228 WP_000059133.1.12751 WP_000059133.1.13024 WP_000059133.1.13113 WP_000059133.1.13115 WP_000059133.1.13221 WP_000059133.1.13233 WP_000059133.1.13299 WP_000059133.1.13424 WP_000059133.1.13820 WP_000059133.1.14084 WP_000059133.1.14721 WP_000059133.1.14855 WP_000059133.1.15163 WP_000059133.1.15460 WP_000059133.1.15502 WP_000059133.1.15569 WP_000059133.1.16156 WP_000059133.1.16170 WP_000059133.1.16199 WP_000059133.1.16997 WP_000059133.1.17146 WP_000059133.1.17265 WP_000059133.1.17408 WP_000059133.1.17424 WP_000059133.1.17899 WP_000059133.1.17927 WP_000059133.1.1809 WP_000059133.1.1850 WP_000059133.1.18840 WP_000059133.1.18976 WP_000059133.1.1907 WP_000059133.1.19173 WP_000059133.1.19258 WP_000059133.1.19435 WP_000059133.1.19445 WP_000059133.1.195 WP_000059133.1.20390 WP_000059133.1.20643 WP_000059133.1.20665 WP_000059133.1.20680 WP_000059133.1.20687 WP_000059133.1.20865 WP_000059133.1.20973 WP_000059133.1.21021 WP_000059133.1.21172 WP_000059133.1.21258 WP_000059133.1.21643 WP_000059133.1.21776 WP_000059133.1.226 WP_000059133.1.22865 WP_000059133.1.23100 WP_000059133.1.23110 WP_000059133.1.23200 WP_000059133.1.23269 WP_000059133.1.23427 WP_000059133.1.23615 WP_000059133.1.23873 WP_000059133.1.2407 WP_000059133.1.24182 WP_000059133.1.24184 WP_000059133.1.2419 WP_000059133.1.24334 WP_000059133.1.24338 WP_000059133.1.24377 WP_000059133.1.24556 WP_000059133.1.24608 WP_000059133.1.24676 WP_000059133.1.24709 WP_000059133.1.24759 WP_000059133.1.24792 WP_000059133.1.24969 WP_000059133.1.2521 WP_000059133.1.25316 WP_000059133.1.25505 WP_000059133.1.25572 WP_000059133.1.2569 WP_000059133.1.25716 WP_000059133.1.25752 WP_000059133.1.25757 WP_000059133.1.26000 WP_000059133.1.2618 WP_000059133.1.26450 WP_000059133.1.26499 WP_000059133.1.26665 WP_000059133.1.26721 WP_000059133.1.26847 WP_000059133.1.27140 WP_000059133.1.27334 WP_000059133.1.27644 WP_000059133.1.27987 WP_000059133.1.28427 WP_000059133.1.28729 WP_000059133.1.28913 WP_000059133.1.29101 WP_000059133.1.29209 WP_000059133.1.29451 WP_000059133.1.29766 WP_000059133.1.29787 WP_000059133.1.30091 WP_000059133.1.30110 WP_000059133.1.30144 WP_000059133.1.30216 WP_000059133.1.3026 WP_000059133.1.30317 WP_000059133.1.30336 WP_000059133.1.30788 WP_000059133.1.3130 WP_000059133.1.31387 WP_000059133.1.31490 WP_000059133.1.31503 WP_000059133.1.31685 WP_000059133.1.3196 WP_000059133.1.3236 WP_000059133.1.32522 WP_000059133.1.32576 WP_000059133.1.33045 WP_000059133.1.33061 WP_000059133.1.33175 WP_000059133.1.3318 WP_000059133.1.33338 WP_000059133.1.33367 WP_000059133.1.33536 WP_000059133.1.33740 WP_000059133.1.33828 WP_000059133.1.33876 WP_000059133.1.34158 WP_000059133.1.34646 WP_000059133.1.35255 WP_000059133.1.35518 WP_000059133.1.3561 WP_000059133.1.35684 WP_000059133.1.35886 WP_000059133.1.3612 WP_000059133.1.3615 WP_000059133.1.36305 WP_000059133.1.36763 WP_000059133.1.3699 WP_000059133.1.37027 WP_000059133.1.37093 WP_000059133.1.37384 WP_000059133.1.37626 WP_000059133.1.37661 WP_000059133.1.37990 WP_000059133.1.38036 WP_000059133.1.38425 WP_000059133.1.38517 WP_000059133.1.39001 WP_000059133.1.39538 WP_000059133.1.39781 WP_000059133.1.4039 WP_000059133.1.40550 WP_000059133.1.40839 WP_000059133.1.41083 WP_000059133.1.41165 WP_000059133.1.41365 WP_000059133.1.41675 WP_000059133.1.41976 WP_000059133.1.42165 WP_000059133.1.42182 WP_000059133.1.42217 WP_000059133.1.42237 WP_000059133.1.42941 WP_000059133.1.43104 WP_000059133.1.43533 WP_000059133.1.43762 WP_000059133.1.4439 WP_000059133.1.44449 WP_000059133.1.44463 WP_000059133.1.4447 WP_000059133.1.44483 WP_000059133.1.4453 WP_000059133.1.45089 WP_000059133.1.45305 WP_000059133.1.45385 WP_000059133.1.45533 WP_000059133.1.46236 WP_000059133.1.46244 WP_000059133.1.46349 WP_000059133.1.46476 WP_000059133.1.4649 WP_000059133.1.46524 WP_000059133.1.46549 WP_000059133.1.46586 WP_000059133.1.46699 WP_000059133.1.46746 WP_000059133.1.46864 WP_000059133.1.47095 WP_000059133.1.47097 WP_000059133.1.47145 WP_000059133.1.473 WP_000059133.1.474 WP_000059133.1.47441 WP_000059133.1.4763 WP_000059133.1.47644 WP_000059133.1.47798 WP_000059133.1.47936 WP_000059133.1.48010 WP_000059133.1.48164 WP_000059133.1.48311 WP_000059133.1.48599 WP_000059133.1.49056 WP_000059133.1.49428 WP_000059133.1.49802 WP_000059133.1.49831 WP_000059133.1.499 WP_000059133.1.50316 WP_000059133.1.50350 WP_000059133.1.50416 WP_000059133.1.50514 WP_000059133.1.50770 WP_000059133.1.51087 WP_000059133.1.51099 WP_000059133.1.51167 WP_000059133.1.51335 WP_000059133.1.51556 WP_000059133.1.51656 WP_000059133.1.51749 WP_000059133.1.52494 WP_000059133.1.52532 WP_000059133.1.52756 WP_000059133.1.52794 WP_000059133.1.52932 WP_000059133.1.53137 WP_000059133.1.53493 WP_000059133.1.53621 WP_000059133.1.53683 WP_000059133.1.53879 WP_000059133.1.54117 WP_000059133.1.54189 WP_000059133.1.54419 WP_000059133.1.54775 WP_000059133.1.54782 WP_000059133.1.55057 WP_000059133.1.55788 WP_000059133.1.55811 WP_000059133.1.55893 WP_000059133.1.55958 WP_000059133.1.55968 WP_000059133.1.56042 WP_000059133.1.56055 WP_000059133.1.56176 WP_000059133.1.56270 WP_000059133.1.5628 WP_000059133.1.56318 WP_000059133.1.56549 WP_000059133.1.56580 WP_000059133.1.56959 WP_000059133.1.57203 WP_000059133.1.57245 WP_000059133.1.57565 WP_000059133.1.57815 WP_000059133.1.57859 WP_000059133.1.58037 WP_000059133.1.58160 WP_000059133.1.58328 WP_000059133.1.5841 WP_000059133.1.58814 WP_000059133.1.59052 WP_000059133.1.59075 WP_000059133.1.59095 WP_000059133.1.59173 WP_000059133.1.59310 WP_000059133.1.59575 WP_000059133.1.59773 WP_000059133.1.59978 WP_000059133.1.60274 WP_000059133.1.60402 WP_000059133.1.60781 WP_000059133.1.60841 WP_000059133.1.61213 WP_000059133.1.61231 WP_000059133.1.61481 WP_000059133.1.61820 WP_000059133.1.61919 WP_000059133.1.61944 WP_000059133.1.62107 WP_000059133.1.62300 WP_000059133.1.62978 WP_000059133.1.6340 WP_000059133.1.63560 WP_000059133.1.63611 WP_000059133.1.64377 WP_000059133.1.64491 WP_000059133.1.64615 WP_000059133.1.64666 WP_000059133.1.64706 WP_000059133.1.64770 WP_000059133.1.65758 WP_000059133.1.65983 WP_000059133.1.66331 WP_000059133.1.66357 WP_000059133.1.66535 WP_000059133.1.66932 WP_000059133.1.67108 WP_000059133.1.67239 WP_000059133.1.67283 WP_000059133.1.6753 WP_000059133.1.68607 WP_000059133.1.69203 WP_000059133.1.69323 WP_000059133.1.69703 WP_000059133.1.69822 WP_000059133.1.69894 WP_000059133.1.69970 WP_000059133.1.70065 WP_000059133.1.70209 WP_000059133.1.70645 WP_000059133.1.7096 WP_000059133.1.70996 WP_000059133.1.71142 WP_000059133.1.71441 WP_000059133.1.71648 WP_000059133.1.71895 WP_000059133.1.71953 WP_000059133.1.72514 WP_000059133.1.72554 WP_000059133.1.72704 WP_000059133.1.72912 WP_000059133.1.73325 WP_000059133.1.73329 WP_000059133.1.7398 WP_000059133.1.74226 WP_000059133.1.74337 WP_000059133.1.74538 WP_000059133.1.74901 WP_000059133.1.75358 WP_000059133.1.75374 WP_000059133.1.7545 WP_000059133.1.75499 WP_000059133.1.75554 WP_000059133.1.75870 WP_000059133.1.76125 WP_000059133.1.7628 WP_000059133.1.76342 WP_000059133.1.76783 WP_000059133.1.77370 WP_000059133.1.77576 WP_000059133.1.77668 WP_000059133.1.77690 WP_000059133.1.77824 WP_000059133.1.77902 WP_000059133.1.77968 WP_000059133.1.782 WP_000059133.1.78264 WP_000059133.1.7856 WP_000059133.1.78644 WP_000059133.1.79043 WP_000059133.1.79250 WP_000059133.1.79252 WP_000059133.1.79315 WP_000059133.1.79584 WP_000059133.1.79658 WP_000059133.1.79687 WP_000059133.1.80239 WP_000059133.1.80439 WP_000059133.1.80571 WP_000059133.1.80695 WP_000059133.1.80955 WP_000059133.1.80964 WP_000059133.1.81088 WP_000059133.1.81198 WP_000059133.1.81799 WP_000059133.1.82289 WP_000059133.1.82421 WP_000059133.1.82533 WP_000059133.1.82566 WP_000059133.1.82986 WP_000059133.1.83070 WP_000059133.1.83206 WP_000059133.1.8365 WP_000059133.1.83938 WP_000059133.1.83951 WP_000059133.1.84045 WP_000059133.1.84323 WP_000059133.1.84337 WP_000059133.1.84422 WP_000059133.1.8450 WP_000059133.1.85689 WP_000059133.1.85901 WP_000059133.1.86041 WP_000059133.1.86082 WP_000059133.1.86119 WP_000059133.1.86140 WP_000059133.1.86239 WP_000059133.1.86288 WP_000059133.1.8698 WP_000059133.1.8759 WP_000059133.1.87627 WP_000059133.1.87960 WP_000059133.1.8825 WP_000059133.1.88431 WP_000059133.1.88641 WP_000059133.1.8907 WP_000059133.1.8923 WP_000059133.1.89325 WP_000059133.1.89675 WP_000059133.1.89698 WP_000059133.1.89704 WP_000059133.1.90155 WP_000059133.1.90187 WP_000059133.1.90596 WP_000059133.1.90671 WP_000059133.1.90791 WP_000059133.1.90883 WP_000059133.1.91080 WP_000059133.1.91404 WP_000059133.1.91569 WP_000059133.1.91615 WP_000059133.1.9186 WP_000059133.1.92347 WP_000059133.1.92586 WP_000059133.1.92686 WP_000059133.1.9269 WP_000059133.1.92831 WP_000059133.1.93271 WP_000059133.1.93290 WP_000059133.1.93744 WP_000059133.1.93893 WP_000059133.1.93904 WP_000059133.1.93927 WP_000059133.1.93932 WP_000059133.1.94237 WP_000059133.1.94270 WP_000059133.1.94322 WP_000059133.1.94373 WP_000059133.1.94784 WP_000059133.1.95308 WP_000059133.1.95457 WP_000059133.1.95484 WP_000059133.1.95786 WP_000059133.1.96356 WP_000059133.1.96934 WP_000059133.1.97149 WP_000059133.1.97617 WP_000059133.1.97781 WP_000059133.1.97861 WP_000059133.1.98216 WP_000059133.1.98519 WP_000059133.1.98557 WP_000059133.1.98571 WP_000059133.1.99266 WP_000059133.1.99445 WP_000059133.1.99454 WP_000059133.1.99485 WP_000059133.1.99994 YP_030235.1.16718 YP_038134.1.62562 gi|30264152|ref|NP_846529.1| gi|217961568|ref|YP_002340138.1| gi|227816854|ref|YP_002816863.1| gi|118479278|ref|YP_896429.1| gi|375286082|ref|YP_005106521.1| gi|225866061|ref|YP_002751439.1| gi|384181898|ref|YP_005567660.1| gi|376267976|ref|YP_005120688.1| gi|52141417|ref|YP_085411.1| 198094.BA_4296 222523.BCE_4144 260799.BAS3985 261594.GBAA4296 281309.BT9727_3815 288681.BCZK3831 405534.BCAH187_A4207 405535.BCAH820_4096 412694.BALH_3692 568206.BAMEG_4336 572264.BCA_4187 592021.BAA_4318 gi|42783190|ref|NP_980437.1| gi|229601768|ref|YP_002868376.1| gi|49478858|ref|YP_038134.1| gi|557620884|ref|YP_008782015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]