SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262316.MAP0885c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262316.MAP0885c
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262316.MAP0885c
Sequence length 254
Comment (Mycobacterium avium paratuberculosis)
Sequence
MSRVAESAGSLAVSTRTDDAATVLTVDGVLDPASSTLLRDRIIKATLDQTRAVVIDVSAL
KVNAESTWSTFMATYWQLGNTPHVPLVLVCAKKAAREAIARSGITHFMPVYSSQKAALKA
LGPNSRRIVRRADAQLPADLTSLRESRRLVREWLTTWSQSKLIPVALVVVNVFVENVLEH
TASVPVMRVEAQGTTATIAVSDASNTPAVRLPSPVKGIDVSGLAIVDALSRAWGSTPTAS
GKTVWAIIGPENQL
Download sequence
Identical sequences A0A200GQG1 Q742F0 V7KM80
262316.MAP0885c gi|499077285|ref|YP_007972763.1| gi|41406983|ref|NP_959819.1| WP_003872843.1.10000 WP_003872843.1.101064 WP_003872843.1.1614 WP_003872843.1.17915 WP_003872843.1.1994 WP_003872843.1.22949 WP_003872843.1.26008 WP_003872843.1.27804 WP_003872843.1.29527 WP_003872843.1.3468 WP_003872843.1.35500 WP_003872843.1.35606 WP_003872843.1.37369 WP_003872843.1.37642 WP_003872843.1.40837 WP_003872843.1.4542 WP_003872843.1.45459 WP_003872843.1.45501 WP_003872843.1.47364 WP_003872843.1.53280 WP_003872843.1.56366 WP_003872843.1.59922 WP_003872843.1.646 WP_003872843.1.66027 WP_003872843.1.66905 WP_003872843.1.6888 WP_003872843.1.74562 WP_003872843.1.76287 WP_003872843.1.78145 WP_003872843.1.81101 WP_003872843.1.81559 WP_003872843.1.8174 WP_003872843.1.82097 WP_003872843.1.82175 WP_003872843.1.82859 WP_003872843.1.83216 WP_003872843.1.88396 WP_003872843.1.89157 WP_003872843.1.9350 WP_003872843.1.98852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]