SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262316.MAP1213 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262316.MAP1213
Domain Number 1 Region: 85-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000144
Family NfeD domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 262316.MAP1213
Sequence length 147
Comment (Mycobacterium avium paratuberculosis)
Sequence
MPHARRGALANIRAGAGRCGGPHRPSVPGDARRGRAGRGADQLADRFPGVAERAVFLVVS
VLLLVVVRPPLRRRLTPAAVPQLGIVALEGKTALVLERVARDRGQVKLDGQVWTARPLDE
NDVYEPGEPVTVMQIDGATAVVFKSSL
Download sequence
Identical sequences Q740X9
gi|41407311|ref|NP_960147.1| gi|499076961|ref|YP_007972439.1| 262316.MAP1213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]