SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262316.MAP2361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262316.MAP2361
Domain Number 1 Region: 428-527
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000387
Family Histidine kinase 0.025
Further Details:      
 
Domain Number 2 Region: 560-631
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000903
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 
Domain Number 3 Region: 192-396
Classification Level Classification E-value
Superfamily PP2C-like 0.00000105
Family PP2C-like 0.018
Further Details:      
 
Domain Number 4 Region: 17-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000209
Family Heme-binding PAS domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262316.MAP2361
Sequence length 655
Comment (Mycobacterium avium paratuberculosis)
Sequence
MVAEKDWDRIVGAADDVRRVFDNVPALLVGLEGPDHRFVAVNAAYRALSPPVDPIGLLAR
EVYPELESQQIFQMFDRVYQTGEPQSGTEWRVQADFEGVGKAQEHFFDFIVTPRRGDDGS
IEGVQLAFVDVTDRVRNRMAAEARLEELSERYRNVRDSATVMQQALLAPSVPVTPGADVT
AEYLVAAQDTAAGGDWFDAIPLGDRLVLIVGDVVGHGVEAAAVMSQLRTALRMQILAGYP
IAEALEAVDRFHKHVPGSSSATMCVGSLDFGSGEFSYCTAGHPPPLLVTADATARYVEPS
GAGPLGSGTGFPVRTEFLDVGDSILLYTDGLIERPGRPLGASTAEFADLAANIVSGQGGF
VIESSVRTADRLCAETLELLLRSTGYSDDVTLLAAQRRTPPPPLNLTLDATIHAARTVRT
RLRQWLSDVGADADDISDIVHAISEFVENAVEHGYATEVPDGVVVEAMLAGDGNLHASVI
DRGRWKDHREGETGRGRGLAMAEALVSEAHVSHGPEGTTARVTHRLSRPANFVADSLVSR
AGDHGVRSAEFVSTVTEPGRIVVSGDVDSNTASTLDRQIAVESRSGVAPLTVDLSAVTHL
GSAGVSALAAARERALRQGSDYVLVAPPGSPAHHVLSLVQIPVVSGLAENVVAEG
Download sequence
Identical sequences A0A202FTK7 Q73XE8
gi|41408459|ref|NP_961295.1| gi|499075828|ref|YP_007971306.1| WP_003877403.1.101064 WP_003877403.1.1614 WP_003877403.1.17915 WP_003877403.1.1994 WP_003877403.1.22949 WP_003877403.1.26008 WP_003877403.1.27804 WP_003877403.1.29527 WP_003877403.1.35606 WP_003877403.1.37369 WP_003877403.1.37642 WP_003877403.1.4542 WP_003877403.1.45459 WP_003877403.1.45501 WP_003877403.1.56366 WP_003877403.1.59922 WP_003877403.1.646 WP_003877403.1.66027 WP_003877403.1.66905 WP_003877403.1.76287 WP_003877403.1.81101 WP_003877403.1.81559 WP_003877403.1.8174 WP_003877403.1.82097 WP_003877403.1.82859 WP_003877403.1.83216 WP_003877403.1.88396 WP_003877403.1.89157 WP_003877403.1.9350 WP_003877403.1.98852 262316.MAP2361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]