SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262543.Exig_0817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262543.Exig_0817
Domain Number 1 Region: 100-159
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000209
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262543.Exig_0817
Sequence length 169
Comment (Exiguobacterium sibiricum 255 15)
Sequence
MSFSLGMILAVFMIGVLMLLVEIFVTGFGIFGVLGIGAVLASLIMAGATVGQVGLAVGLA
VFLSLAAGFWAYRRIKSNQSLLWRGLILTDSTSSEKGYLSHQDKEQLRGKVGISLTQLRP
AGTIEIDGNRVDAVTEGNFINSGEQVVVQDVTHGRVIVRVQKTKEESLT
Download sequence
Identical sequences B1YL65
262543.Exig_0817 WP_012369721.1.68707 gi|172056854|ref|YP_001813314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]