SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262543.Exig_2806 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262543.Exig_2806
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262543.Exig_2806
Sequence length 108
Comment (Exiguobacterium sibiricum 255 15)
Sequence
MDLTIKTEQLDGQTHLYIAGEIDTYTAPKLRQELVPAVETNDVVVHLDEIHYMDSTGLGV
FVGALKASKKNGTSFTLVGVSERIRRLFEITGLSSIITIDSGVRGGTQ
Download sequence
Identical sequences B1YF28
gi|172058809|ref|YP_001815269.1| 262543.Exig_2806 WP_012371668.1.68707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]