SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262698.BruAb1_1368 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  262698.BruAb1_1368
Domain Number - Region: 62-168
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000424
Family Voltage-gated potassium channels 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262698.BruAb1_1368
Sequence length 341
Comment (Brucella abortus bv 1 9 941)
Sequence
MDTLLHLIAILIGIFGLLVYFRSVIRVMLLNWRERDLISYFAAVAAVVLIRRFTDSGAGY
ERIQRSQAWVFPVFVILSVAFWFLLVQLCFTLILWGTRAETSFIYSFTASGSALSTLGFK
TPSSWLGEFLAIVEGAMGLAIVVLLFSFVPGYLAAVQARERKVGWLYDRTEGHPTYQTVL
EGMNTSEQDINDTGIWEDWEAWFRGIYETHTTAPILTFVPSIYHGANWLRTSASILDTAS
LLMSVLDEKKTYAAHMCRDIGARTIQLLAKELHITAPSLGRAIPHSPDLPANTFDLVYNQ
LVANGVPVNPDKEKCRETFTQLRAEYAADLNQISRITSMPL
Download sequence
Identical sequences A0A0F6ARG0 A0A0M1WAU7 A0A2K4NKS6 C4IS54 Q2YQP0 Q57CD5
WP_002966885.1.100443 WP_002966885.1.101965 WP_002966885.1.102082 WP_002966885.1.10322 WP_002966885.1.10630 WP_002966885.1.11620 WP_002966885.1.12041 WP_002966885.1.12241 WP_002966885.1.13460 WP_002966885.1.13826 WP_002966885.1.14633 WP_002966885.1.15077 WP_002966885.1.16975 WP_002966885.1.19508 WP_002966885.1.19641 WP_002966885.1.20012 WP_002966885.1.22583 WP_002966885.1.2337 WP_002966885.1.24196 WP_002966885.1.24428 WP_002966885.1.24655 WP_002966885.1.24726 WP_002966885.1.25382 WP_002966885.1.26599 WP_002966885.1.2778 WP_002966885.1.2839 WP_002966885.1.2874 WP_002966885.1.28889 WP_002966885.1.31106 WP_002966885.1.31239 WP_002966885.1.32337 WP_002966885.1.32492 WP_002966885.1.32731 WP_002966885.1.33599 WP_002966885.1.33753 WP_002966885.1.35056 WP_002966885.1.35970 WP_002966885.1.38353 WP_002966885.1.39039 WP_002966885.1.39963 WP_002966885.1.40407 WP_002966885.1.40624 WP_002966885.1.40649 WP_002966885.1.40871 WP_002966885.1.41044 WP_002966885.1.41311 WP_002966885.1.41835 WP_002966885.1.42103 WP_002966885.1.42427 WP_002966885.1.43597 WP_002966885.1.4428 WP_002966885.1.45559 WP_002966885.1.46182 WP_002966885.1.46432 WP_002966885.1.4727 WP_002966885.1.47558 WP_002966885.1.47610 WP_002966885.1.50051 WP_002966885.1.50053 WP_002966885.1.50282 WP_002966885.1.5052 WP_002966885.1.5236 WP_002966885.1.53128 WP_002966885.1.53481 WP_002966885.1.5394 WP_002966885.1.54440 WP_002966885.1.54776 WP_002966885.1.54779 WP_002966885.1.55440 WP_002966885.1.55684 WP_002966885.1.56334 WP_002966885.1.56683 WP_002966885.1.56952 WP_002966885.1.57925 WP_002966885.1.58539 WP_002966885.1.59086 WP_002966885.1.61325 WP_002966885.1.61536 WP_002966885.1.61811 WP_002966885.1.61997 WP_002966885.1.63730 WP_002966885.1.64013 WP_002966885.1.64124 WP_002966885.1.64853 WP_002966885.1.64905 WP_002966885.1.65131 WP_002966885.1.65454 WP_002966885.1.66078 WP_002966885.1.66260 WP_002966885.1.66810 WP_002966885.1.67893 WP_002966885.1.67996 WP_002966885.1.67997 WP_002966885.1.68913 WP_002966885.1.69451 WP_002966885.1.69829 WP_002966885.1.70322 WP_002966885.1.71194 WP_002966885.1.71689 WP_002966885.1.71846 WP_002966885.1.7206 WP_002966885.1.72916 WP_002966885.1.75434 WP_002966885.1.75458 WP_002966885.1.76350 WP_002966885.1.76433 WP_002966885.1.77321 WP_002966885.1.77899 WP_002966885.1.78109 WP_002966885.1.7984 WP_002966885.1.79963 WP_002966885.1.80266 WP_002966885.1.80476 WP_002966885.1.80697 WP_002966885.1.81617 WP_002966885.1.81822 WP_002966885.1.82113 WP_002966885.1.8224 WP_002966885.1.8278 WP_002966885.1.8307 WP_002966885.1.85769 WP_002966885.1.8657 WP_002966885.1.87522 WP_002966885.1.87603 WP_002966885.1.87867 WP_002966885.1.8788 WP_002966885.1.8878 WP_002966885.1.90689 WP_002966885.1.91123 WP_002966885.1.91338 WP_002966885.1.91710 WP_002966885.1.92518 WP_002966885.1.93454 WP_002966885.1.93795 WP_002966885.1.94126 WP_002966885.1.94555 WP_002966885.1.94775 WP_002966885.1.97511 WP_002966885.1.97741 WP_002966885.1.98076 WP_002966885.1.98455 WP_002966885.1.99373 WP_002966885.1.99421 gi|376272895|ref|YP_005151473.1| gi|82700189|ref|YP_414763.1| gi|62290267|ref|YP_222060.1| 262698.BruAb1_1368 359391.BAB1_1391 430066.BAbS19_I12990 gi|189024500|ref|YP_001935268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]