SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262722.MHP7448_0250 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262722.MHP7448_0250
Domain Number 1 Region: 143-440
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.15e-110
Family Enolase 0.000000109
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.08e-52
Family Enolase N-terminal domain-like 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 262722.MHP7448_0250
Sequence length 452
Comment (Mycoplasma hyopneumoniae 7448)
Sequence
MSKITKVFAREILDSRGNPTIQVDVYTLAGGFGSAIVPSGASTGSREALELRDTNTKYAD
NWYGQKGVMTAVDNVNNIIAPEIIGLCCKNQRLVDQKMIELDGTPNKEKLGANAILGVSL
AVAKAAANELRMPLFRYLGGTNPTLMPVPMLNVINGGEHASNTLDFQEFMIMPLGFRTFK
EALQAANKVFHNLAKLLKKSGFETQVGDEGGFAPNFNSHEQALDFLVDAIKESGFNPGFK
GENAVAIAIDAAASDFYNGQKYVFKKLMAASLSKNQADLDEKFEFSSEELLNYYGQLLAK
YPIISIEDGFAESDWQGFIAFNQKYGNNHQIVGDDLTVTNVEILKKAINLKAINSILIKL
NQIGTLSETLDAIHLAQKSGMTAVISHRSGESEDTTIADLAVAVSSGQIKTGSLSRTDRI
AKYNRLLVIEEYLNSYAKADYIGREVFYNLKK
Download sequence
Identical sequences Q4A8B5
WP_011290109.1.4867 gi|72080589|ref|YP_287647.1| 262722.MHP7448_0250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]