SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262722.MHP7448_0548 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262722.MHP7448_0548
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.58e-27
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262722.MHP7448_0548
Sequence length 142
Comment (Mycoplasma hyopneumoniae 7448)
Sequence
MNLKLENIHLNQIITSKKQAFEKLIRIFQQKNCCEFEYLQSMEKRDLESSVALGNFLALP
HGNFEGNNLIFRNCIEIIHLKNTLNWDGQPVKFVIGLAVKNSEQIDYIQKIGLAFIDVEK
VEEILNDSDLSKQKILDWIINN
Download sequence
Identical sequences Q4A7H5
WP_011290347.1.35737 WP_011290347.1.4867 gi|72080879|ref|YP_287937.1| 262722.MHP7448_0548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]