SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 262724.TTC0519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  262724.TTC0519
Domain Number 1 Region: 113-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.03e-68
Family D-glucarate dehydratase-like 0.000000215
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.75e-33
Family Enolase N-terminal domain-like 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 262724.TTC0519
Sequence length 369
Comment (Thermus thermophilus HB27)
Sequence
MRIEAAELRILELPLKFRFETSFGVQTKRTILLLRLFGEGLEGLGEGVMERLPLYREETV
AGARYLLEEVFLPRVLGRDLPNPEALREALAPFRGNPMAKAVLEMAFFDLWAKALGRPLW
QVLGGVRQAVEVGVSLGIQPSVEDTLRAVEKHLEEGYRRIKLKIKPGWDYEVLKAVREAF
PEATLTADANSAYSLADLARLKRLDELRLDYIEQPLAYDDLLDHAKLQRELSTPICLDES
LTGAEKARKAIELGAGRVFNVKPARLGGHGESLRVHALAQSAGIPLWMGGMLEAGVGRAH
NLHLATLPGFTKPGDVSSASRYWKEDIVEEALEAKDGLMPVPEGVGIGVHLKLPFVERVT
LWQRYMSAS
Download sequence
Identical sequences Q72KC7
gi|46198827|ref|YP_004494.1| 262724.TTC0519 WP_011172964.1.85415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]