SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262768.PAM_298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  262768.PAM_298
Domain Number - Region: 24-67
Classification Level Classification E-value
Superfamily EF-hand 0.000875
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262768.PAM_298
Sequence length 71
Comment (Onion yellows phytoplasma)
Sequence
MNNIWLYVNPIIGFLLGGVLGAFLMFHWFKKHLQQNPPISEKQIKEMFRQMGRTPSEKQI
RQIMNSMKQGK
Download sequence
Identical sequences A0A1B3JL45 A0A1S2NHW6 Q6YQS5
WP_011160672.1.20420 WP_011160672.1.62061 WP_011160672.1.81900 WP_011160672.1.93896 gi|39938784|ref|NP_950550.1| 262768.PAM_298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]