SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 263820.PTO0145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  263820.PTO0145
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-21
Family Voltage-gated potassium channels 0.00094
Further Details:      
 
Domain Number 2 Region: 120-263
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000443
Family Potassium channel NAD-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 263820.PTO0145
Sequence length 322
Comment (Picrophilus torridus DSM 9790)
Sequence
MNFFIIFKRIRKITRRNMFKSIIILIAIIIYSVFSEYILENPIRSSGIHNLFTSLWWTMQ
TITTVGYGDTPVYGFYGRINGMLIMVFGIGTIGYVTASLATILIDSRLSARFGDVMALES
RHVIICNFNSEAKKILKMIDSIGLDIVILSENEPELKEYTYVKGMAIKERDLIKAGIKKA
LTVIVFAKNDDRDSLAIDAETILSAMVIKKLNKNVHVIAELLNPDSREHASAFVDETIVH
GDVTAELIAASIMNPGITNLFSTISQFIKEQVINDDDKRMNYKDFYIKMLNSGKNVIAFK
KGNSVIIKPDDELSNYDAFFYI
Download sequence
Identical sequences Q6L2S2
263820.PTO0145 gi|48477217|ref|YP_022923.1| WP_011176946.1.10384 GO.1465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]